Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Rabbit Polyclonal Antibody (FITC)

ZNF692 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF692

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060335

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

St13 (NM_031122) Rat Tagged ORF Clone
RR203491 10 µg

St13 (NM_031122) Rat Tagged ORF Clone

Sign In for Pricing
View Details
EFTUD2 Overexpression Lysate (Native) - (Dry Ice)
NBP2-07895 0.1 mg

EFTUD2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT
CSB-E07341m-01 96 Tests

Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Sign In for Pricing
View Details
Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT
CSB-E07341m-02 5x 96 Tests

Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Sign In for Pricing
View Details
Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT
CSB-E07341m-03 10x 96 Tests

Mouse glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Sign In for Pricing
View Details
(3- (Pent-4-ynamido) phenyl) boronic acid
OR1061541-01 100 mg

(3- (Pent-4-ynamido) phenyl) boronic acid

Sign In for Pricing
View Details