Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Rabbit Polyclonal Antibody (Biotin)

ZNF692 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF692

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060335

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep anti Mouse IgG Fab, conjugated with FITC
ShAM/Fab/FITC 1 mL

Sheep anti Mouse IgG Fab, conjugated with FITC

Sign In for Pricing
View Details
Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (Biotin)
C7853-41-Biotin 100 µL

Connexin 30.3 (CX30.3, Gap Junction Beta 5 Protein, CXB5) (Biotin)

Sign In for Pricing
View Details
Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)
MBS1454829-01 0.02 mg (E-Coli)

Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)

Sign In for Pricing
View Details
Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)
MBS1454829-02 0.02 mg (Yeast)

Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)

Sign In for Pricing
View Details
Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)
MBS1454829-03 0.1 mg (E-Coli)

Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)

Sign In for Pricing
View Details
Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)
MBS1454829-04 0.1 mg (Yeast)

Recombinant Human Secretion-regulating guanine nucleotide exchange factor (SERGEF)

Sign In for Pricing
View Details