Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP64 Rabbit Polyclonal Antibody (Biotin)

ZFP64 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF338

UniProt

Q9NTW7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP64

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1C2 Mouse Monoclonal Antibody [Clone ID: OTI8C2]
TA808258 100 µL

ATP6V1C2 Mouse Monoclonal Antibody [Clone ID: OTI8C2]

Sign In for Pricing
View Details
CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (FITC) discontinued
034229-FITC 200 µL

CRISP1, CT (CRISP1, AEGL1, Cysteine-rich secretory protein 1, AEG-like protein, ARP, Acidic epididymal glycoprotein homolog) (FITC) discontinued

Sign In for Pricing
View Details
Breast carcinoma (Her2 3+) tissue array with survival data, including prognosis, pathology grade, TNM and clinical stage, 70 cases/140 cores.
S-FMG140M 70 Cases / 140 Cores

Breast carcinoma (Her2 3+) tissue array with survival data, including prognosis, pathology grade, TNM and clinical stage, 70 cases/140 cores.

Sign In for Pricing
View Details
TUBB4Q, NT (Putative tubulin beta-4q chain,TUBB4Q,TUB4Q) (Biotin)
MBS6360180-01 0.2 mL

TUBB4Q, NT (Putative tubulin beta-4q chain,TUBB4Q,TUB4Q) (Biotin)

Sign In for Pricing
View Details
TUBB4Q, NT (Putative tubulin beta-4q chain,TUBB4Q,TUB4Q) (Biotin)
MBS6360180-02 5x 0.2 mL

TUBB4Q, NT (Putative tubulin beta-4q chain,TUBB4Q,TUB4Q) (Biotin)

Sign In for Pricing
View Details
S1PR4 Antibody
A45386-50UL 50 μL

S1PR4 Antibody

Sign In for Pricing
View Details