Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF395 Rabbit Polyclonal Antibody (HRP)

ZNF395 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PBF, PRF1, HDBP2, PRF-1, HDBP-2, HDRF-2, Si-1-8-14

UniProt

Q9H8N7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF395

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_061130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxynonenal Antibody (HRP)
abx443635 100 µg

4-Hydroxynonenal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Interleukin 17 (IL-17) ELISA Kit
orb2812911-01 48 Tests

Mouse Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17 (IL-17) ELISA Kit
orb2812911-02 96 Tests

Mouse Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 17 (IL-17) ELISA Kit
orb2812911-03 5 x 96 T

Mouse Interleukin 17 (IL-17) ELISA Kit

Sign In for Pricing
View Details
ELOVL5 Recombinant Antibody, APC Conjugated
bsm-62773R-APC-01 20 µL

ELOVL5 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
ELOVL5 Recombinant Antibody, APC Conjugated
bsm-62773R-APC-02 100 µL

ELOVL5 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details