Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF313 Rabbit Polyclonal Antibody (HRP)

ZNF313 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF313, PSORS12

UniProt

Q9Y508

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF313

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_061153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal anti-human CD53
hAP-1169 50 µg

Mouse Monoclonal anti-human CD53

Sign In for Pricing
View Details
4,5-Dibromo-2- (4,5-dibromoimidazol-2-yl) imidazole
OR24798 1 Each

4,5-Dibromo-2- (4,5-dibromoimidazol-2-yl) imidazole

Sign In for Pricing
View Details
ZNF551, ID (ZNF551, KOX23, Zinc finger protein 551, Zinc finger protein KOX23) (MaxLight 750)
MBS6366941-01 0.1 mL

ZNF551, ID (ZNF551, KOX23, Zinc finger protein 551, Zinc finger protein KOX23) (MaxLight 750)

Sign In for Pricing
View Details
ZNF551, ID (ZNF551, KOX23, Zinc finger protein 551, Zinc finger protein KOX23) (MaxLight 750)
MBS6366941-02 5x 0.1 mL

ZNF551, ID (ZNF551, KOX23, Zinc finger protein 551, Zinc finger protein KOX23) (MaxLight 750)

Sign In for Pricing
View Details
CASS4 (NM_001164115) Human Over-expression Lysate
LC431306 20 µg

CASS4 (NM_001164115) Human Over-expression Lysate

Sign In for Pricing
View Details
EGF-Like module-containing mucin-Like Hormone Receptor-Like 1 (EMR1) Human ELISA Kit
D1184 96 Tests

EGF-Like module-containing mucin-Like Hormone Receptor-Like 1 (EMR1) Human ELISA Kit

Sign In for Pricing
View Details