Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBX Rabbit Polyclonal Antibody (FITC)

BBX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HBP2, ARTC1, MDS001, HSPC339

UniProt

Q8WY36

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BBX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLLDFSEEEEEEDEEEDIDKVQLLGADGLEQDVGETEDDESPEQRARRPM

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit
MBS9351026-01 48 Well

Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit

Sign In for Pricing
View Details
Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit
MBS9351026-02 96 Well

Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit

Sign In for Pricing
View Details
Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit
MBS9351026-03 5x 96 Well

Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit

Sign In for Pricing
View Details
Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit
MBS9351026-04 10x 96 Well

Horse Tyrosine-Protein Kinase Transmembrane Receptor ROR2 (ROR2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae MLBr01503.1 Protein (aa 1-94)
VAng-Yyj2162-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae MLBr01503.1 Protein (aa 1-94)

Sign In for Pricing
View Details
Recombinant Caperea marginata NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
MBS7022162-01 0.02 mg

Recombinant Caperea marginata NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Sign In for Pricing
View Details