Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBX Rabbit Polyclonal Antibody (HRP)

BBX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HBP2, ARTC1, MDS001, HSPC339

UniProt

Q8WY36

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BBX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064620

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MRPL44 siRNA
abx924640-01 15 nmol

Mouse MRPL44 siRNA

Sign In for Pricing
View Details
Mouse MRPL44 siRNA
abx924640-02 30 nmol

Mouse MRPL44 siRNA

Sign In for Pricing
View Details
TCEAL4 antibody - middle region (ARP50341_P050)
ARP50341_P050 100 µL

TCEAL4 antibody - middle region (ARP50341_P050)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pet127 Polyclonal Antibody
MBS7181830 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pet127 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Axl [p Tyr779] Antibody (713610) [PerCP]
FAB6965C 0.1 mL

Mouse Monoclonal Axl [p Tyr779] Antibody (713610) [PerCP]

Sign In for Pricing
View Details
Anti Mullerian Hormone (AMH)/Mullerian Inhibiting Substance (MIS) Recombinant Rabbit Monoclonal Antibody [Clone AMH/6713R]
MBS4381936-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

Anti Mullerian Hormone (AMH)/Mullerian Inhibiting Substance (MIS) Recombinant Rabbit Monoclonal Antibody [Clone AMH/6713R]

Sign In for Pricing
View Details