Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBX Rabbit Polyclonal Antibody (Biotin)

BBX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HBP2, ARTC1, MDS001, HSPC339

UniProt

Q8WY36

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BBX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064620

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 2 (vWA2)
TRV-0023348-01 200 µL

FITC-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 2 (vWA2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 2 (vWA2)
TRV-0023348-02 1 mL

FITC-Linked Polyclonal Antibody to Von Willebrand Factor A Domain Containing Protein 2 (vWA2)

Sign In for Pricing
View Details
E4f1 3'UTR GFP Stable Cell Line
TU253740 1.0 mL

E4f1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (Biotin)
MBS6375866-01 0.1 mL

DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (Biotin)

Sign In for Pricing
View Details
DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (Biotin)
MBS6375866-02 5x 0.1 mL

DDOST (Dolichyl-diphosphooligosaccharide-Protein Glycosyltransferase 48kD Subunit, Oligosaccharyl Transferase 48kD Subunit, DDOST 48kD Subunit, KIAA0115, OST48, OK/SW-cl.45) (Biotin)

Sign In for Pricing
View Details
Theobromine
S2368-50mg 50 mg

Theobromine

Sign In for Pricing
View Details