Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNL1 Rabbit Polyclonal Antibody (HRP)

CCNL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANIA6A, BM-001, PRO1073, ania-6a

UniProt

Q8NI48

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Eukaryotic translation initiation factor 5A-1,EIF5A ELISA KIT
JOT-EK7267Hu-01 96 Well

Human Eukaryotic translation initiation factor 5A-1,EIF5A ELISA KIT

Sign In for Pricing
View Details
Human Eukaryotic translation initiation factor 5A-1,EIF5A ELISA KIT
JOT-EK7267Hu-02 48 Well

Human Eukaryotic translation initiation factor 5A-1,EIF5A ELISA KIT

Sign In for Pricing
View Details
3- (2-Aminophenyl) -1H-pyrazole
OR183453 250 mg

3- (2-Aminophenyl) -1H-pyrazole

Sign In for Pricing
View Details
Recombinant Escherichia coli Inner membrane protein yejM (yejM)
MBS7034353-01 0.02 mg

Recombinant Escherichia coli Inner membrane protein yejM (yejM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Inner membrane protein yejM (yejM)
MBS7034353-02 0.1 mg

Recombinant Escherichia coli Inner membrane protein yejM (yejM)

Sign In for Pricing
View Details
Recombinant Escherichia coli Inner membrane protein yejM (yejM)
MBS7034353-03 5x 0.1 mg

Recombinant Escherichia coli Inner membrane protein yejM (yejM)

Sign In for Pricing
View Details