Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNL1 Rabbit Polyclonal Antibody (Biotin)

CCNL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ANIA6A, BM-001, PRO1073, ania-6a

UniProt

Q8NI48

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD14 ELISA Kit
orb526786 96 Tests

Human CD14 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human APEX1 sgRNA gene knockout kit - Lentiviral human APEX1 sgRNA gene knockout kit (100)
GTR15384877 1 Vial

Lentiviral human APEX1 sgRNA gene knockout kit - Lentiviral human APEX1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PHF17 Protein Vector (Mouse) (pPM-C-HA)
PV215688 500 ng

PHF17 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Urocortin (UCN) ELISA Kit
MBS284633-01 48 Tests

Rat Urocortin (UCN) ELISA Kit

Sign In for Pricing
View Details
Rat Urocortin (UCN) ELISA Kit
MBS284633-02 96 Tests

Rat Urocortin (UCN) ELISA Kit

Sign In for Pricing
View Details
Rat Urocortin (UCN) ELISA Kit
MBS284633-03 5x 96 Tests

Rat Urocortin (UCN) ELISA Kit

Sign In for Pricing
View Details