Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnl1 Rabbit Polyclonal Antibody (HRP)

Ccnl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ccnl, Ania-6a

UniProt

Q9R1Q2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin (CNN1) Mouse Monoclonal Antibody [Clone ID: OTI3H2]
TA813853 100 µL

Calponin (CNN1) Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details
T-complex Protein 1 Subunit gamma, CT (CCT3, TCP-1-gamma, CCT-gamma, hTRiC5, TRIC5, CCTG) (MaxLight 490) discontinued
T2035-11-ML490 100 µL

T-complex Protein 1 Subunit gamma, CT (CCT3, TCP-1-gamma, CCT-gamma, hTRiC5, TRIC5, CCTG) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SLC22A2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43947156 3x 1.0 µg DNA

SLC22A2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Methyl 1- (1,3-benzoxazol-2-yl) piperidine-4-carboxylate
QTB40136-01 50 mg

Methyl 1- (1,3-benzoxazol-2-yl) piperidine-4-carboxylate

Sign In for Pricing
View Details
Methyl 1- (1,3-benzoxazol-2-yl) piperidine-4-carboxylate
QTB40136-02 0.5 g

Methyl 1- (1,3-benzoxazol-2-yl) piperidine-4-carboxylate

Sign In for Pricing
View Details
RSPH9 CRISPR Knock Out 293T Cell Line (Human)
42797141 1x 10^6 Cells / 1.0 mL

RSPH9 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details