Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnl1 Rabbit Polyclonal Antibody (HRP)

Ccnl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ccnl, Ania-6a

UniProt

Q9R1Q2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Med23 shRNA (UAS) - Lentiviral mouse Med23 shRNA (UAS) plasmid
GTR15135391 1 Vial

Lentiviral mouse Med23 shRNA (UAS) - Lentiviral mouse Med23 shRNA (UAS) plasmid

Sign In for Pricing
View Details
STK16 discontinued
394980-01 20 µL

STK16 discontinued

Sign In for Pricing
View Details
STK16 discontinued
394980-02 200 µL

STK16 discontinued

Sign In for Pricing
View Details
alpha TubuLin (TUBA1A) (NM_006009) Human Tagged Lenti ORF Clone
RC208669L3 10 µg

alpha TubuLin (TUBA1A) (NM_006009) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ATP6V0A4 Antibody [mFluor Violet 500 SE]
NBP2-99250MFV500 0.1 mL

Rabbit Polyclonal ATP6V0A4 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
HSCB Recombinant Protein
32-3997-20 20 µg

HSCB Recombinant Protein

Sign In for Pricing
View Details