Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD1 Rabbit Polyclonal Antibody (FITC)

GATAD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ODAG, CMD2B, RG083M05.2

UniProt

Q8WUU5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GATAD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sal Like Protein 4
549833 200 µL

Sal Like Protein 4

Sign In for Pricing
View Details
Dennd2d (NM_001093754) Mouse Tagged ORF Clone
MR216772 10 µg

Dennd2d (NM_001093754) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) (MaxLight 405) discontinued
132256-ML405 100 µL

RAD18 (E3 Ubiquitin-protein Ligase RAD18, Postreplication Repair Protein RAD18, hRAD18, hHR18, RING Finger Protein 73, RNF73) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GST3/GST pi Rabbit pAb
APA3707-01 30 µL

GST3/GST pi Rabbit pAb

Sign In for Pricing
View Details
GST3/GST pi Rabbit pAb
APA3707-02 50 μL

GST3/GST pi Rabbit pAb

Sign In for Pricing
View Details
GST3/GST pi Rabbit pAb
APA3707-03 100 µL

GST3/GST pi Rabbit pAb

Sign In for Pricing
View Details