Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD1 Rabbit Polyclonal Antibody (HRP)

GATAD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ODAG, CMD2B, RG083M05.2

UniProt

Q8WUU5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GATAD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoropropionic Acid
TRC-F598610-5G 5 g

2-Fluoropropionic Acid

Sign In for Pricing
View Details
TFEC Mouse Monoclonal Antibody [Clone ID: OTI2A9]
CF811471 100 µg

TFEC Mouse Monoclonal Antibody [Clone ID: OTI2A9]

Sign In for Pricing
View Details
Human CYP4A22 activation kit by CRISPRa
GA117164 1 Kit

Human CYP4A22 activation kit by CRISPRa

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL
BNC471855-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), 0.2mg/mL
BNUB2423-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2423), 0.2mg/mL

Sign In for Pricing
View Details
DNA Polymerase beta (POLB) Rabbit Polyclonal Antibody
AP06087PU-N 100 µg

DNA Polymerase beta (POLB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details