Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATAD1 Rabbit Polyclonal Antibody (Biotin)

GATAD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ODAG, CMD2B, RG083M05.2

UniProt

Q8WUU5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GATAD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO Conjugating Enzyme UBC9 Rabbit Monoclonal Antibody
E10G22621 100 µL

SUMO Conjugating Enzyme UBC9 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SNORD18C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2225506 1.0 µg DNA

SNORD18C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TubuLin Polymerization Promoting Protein (TPPP) (NM_007030) Human Mass Spec Standard
PH313142 10 µg

TubuLin Polymerization Promoting Protein (TPPP) (NM_007030) Human Mass Spec Standard

Sign In for Pricing
View Details
Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT
E6210Hu-01 48 Well

Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT

Sign In for Pricing
View Details
Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT
E6210Hu-02 96 Well

Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT

Sign In for Pricing
View Details
Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT
E6210Hu-03 5x 96 Tests

Human Sperm associated antigen 9 Antibody, SPAG9-Ab ELISA KIT

Sign In for Pricing
View Details