Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRHL3 Rabbit Polyclonal Antibody (HRP)

GRHL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOM, VWS2, TFCP2L4

UniProt

Q8TE85

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_937817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 650)
127657-ML650 100 µL

GTF3C3 (General Transcription Factor 3C Polypeptide 3, Transcription Factor IIIC 102kD Subunit, Transcription Factor IIIC Subunit gamma) (MaxLight 650)

Sign In for Pricing
View Details
PCMV-FLAG-ADAM15 (human) -mCherry-SV40-Neo
BZ47038 1 Vial

PCMV-FLAG-ADAM15 (human) -mCherry-SV40-Neo

Sign In for Pricing
View Details
DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems 3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3) (MaxLight 550)
125726-ML550 100 µL

DDX20 (DP103, GEMIN3, Probable ATP-dependent RNA Helicase DDX20, Component of Gems 3, DEAD Box Protein 20, DEAD Box Protein DP 103, Gemin-3) (MaxLight 550)

Sign In for Pricing
View Details
Human adrenal cortex antibody, ACA ELISA Kit
NB-E11147-01 96 Well

Human adrenal cortex antibody, ACA ELISA Kit

Sign In for Pricing
View Details
Human adrenal cortex antibody, ACA ELISA Kit
NB-E11147-02 96 Well

Human adrenal cortex antibody, ACA ELISA Kit

Sign In for Pricing
View Details
Anti-CGRP2 Antibody
CQA1729-01 30 µL

Anti-CGRP2 Antibody

Sign In for Pricing
View Details