Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT3 Rabbit Polyclonal Antibody (Biotin)

DMRT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DMRTA3

UniProt

Q9NQL9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DMRT3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NARFL Rabbit pAb, PerCP-Cy7 conjugated
orb2883394 100 µL

NARFL Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Mouse LY6E/SCA-2 Protein, C-Fc
MBS1578781-01 0.1 mg

Recombinant Mouse LY6E/SCA-2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Mouse LY6E/SCA-2 Protein, C-Fc
MBS1578781-02 1 mg

Recombinant Mouse LY6E/SCA-2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Mouse LY6E/SCA-2 Protein, C-Fc
MBS1578781-03 5x 1 mg

Recombinant Mouse LY6E/SCA-2 Protein, C-Fc

Sign In for Pricing
View Details
PI15 (Peptidase Inhibitor 15, PI-15, 25kD Trypsin Inhibitor, p25TI, Cysteine-rich Secretory Protein 8, CRISP-8, SugarCrisp, CRISP8, P25TI, DKFZp686F0366, P24TI) (FITC)
131298-FITC 100 µL

PI15 (Peptidase Inhibitor 15, PI-15, 25kD Trypsin Inhibitor, p25TI, Cysteine-rich Secretory Protein 8, CRISP-8, SugarCrisp, CRISP8, P25TI, DKFZp686F0366, P24TI) (FITC)

Sign In for Pricing
View Details
Lentiviral human PNPO shRNA (UAS) - Lentiviral human PNPO shRNA (UAS, iRFP) plasmid
GTR15163360 1 Vial

Lentiviral human PNPO shRNA (UAS) - Lentiviral human PNPO shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details