Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rb1 Rabbit Polyclonal Antibody (HRP)

Rb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1

UniProt

P13405

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Rb1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL
BNC683177-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P73 (Tumor Suppressor) (P73/2531), 0.2mg/mL
BNUB2531-100 1x 100 µL

P73 (Tumor Suppressor) (P73/2531), 0.2mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL
BNC880863-100 1x 100 µL

Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF568 conjugate, 0.1mg/mL
BNC682478-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2478), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MMP-3 (Matrix Metalloproteinase 3) CLIA Kit
E-CL-H0931-01 24 Tests

Human MMP-3 (Matrix Metalloproteinase 3) CLIA Kit

Sign In for Pricing
View Details
Human MMP-3 (Matrix Metalloproteinase 3) CLIA Kit
E-CL-H0931-02 48 Tests

Human MMP-3 (Matrix Metalloproteinase 3) CLIA Kit

Sign In for Pricing
View Details