Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rb1 Rabbit Polyclonal Antibody (Biotin)

Rb1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1

UniProt

P13405

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Rb1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033055

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMEM/F12 (1:1), w: L-G Lutamine, w: 15 mM HEPES, w/o: NaHCO3, Powder
P03-6110 10 L

DMEM/F12 (1:1), w: L-G Lutamine, w: 15 mM HEPES, w/o: NaHCO3, Powder

Sign In for Pricing
View Details
Bovine 39S ribosomal protein L43, mitochondrial (MRPL43) ELISA Kit
OM619339 96 Strip Well

Bovine 39S ribosomal protein L43, mitochondrial (MRPL43) ELISA Kit

Sign In for Pricing
View Details
Tyro3 Antibody [E18F19]
C18967-50uL 50 μL

Tyro3 Antibody [E18F19]

Sign In for Pricing
View Details
Glycine Receptor, alpha1 (MaxLight 490) discontinued
G8167-ML490 100 µL

Glycine Receptor, alpha1 (MaxLight 490) discontinued

Sign In for Pricing
View Details
Methyl α-L-Arabinopyranoside
016534 5 mg

Methyl α-L-Arabinopyranoside

Sign In for Pricing
View Details
TBD2B rabbit pAb Antibody
orb2303626-01 50 µL

TBD2B rabbit pAb Antibody

Sign In for Pricing
View Details