Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RB1 Rabbit Polyclonal Antibody (FITC)

RB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1

UniProt

P06400

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
RE1136H-01 48 Tests

Human ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
RE1136H-02 96 Tests

Human ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag
057071-01 10 µg

Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag
057071-02 50 µg

Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag
057071-03 100 µg

Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag
057071-04 200 µg

Toll Like Receptor 10 (TLR10), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details