Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 Rabbit Polyclonal Antibody (HRP)

RFX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NYD-SP10

UniProt

Q96S80

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RFX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002911

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRIM1 (NM_000946) Human Over-expression Lysate
LS005557 100 µg

PRIM1 (NM_000946) Human Over-expression Lysate

Sign In for Pricing
View Details
LPPR2 Rabbit Polyclonal Antibody (PE)
orb488965 100 µL

LPPR2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
TAP1 (ABC 17, ABC Transporter MHC 1, ABC17, ABCB 2, ABCB2, Antigenpeptide Transporter 1, APT 1, APT1, ATP Binding cassette sub Family B (MDR/TAP) Member2, ATP Binding cassette sub Family B Member 2, ATP Binding cassette Transporter, D6S114E, FLJ26666, FLJ41500, Peptide supply Factor 1, PeptideTransporter involved in antigen processing 1, Peptide Transporter PSF 1, Peptide Transporter PSF1, Peptide Transporter TAP 1, Peptide Transporter TAP1, PSF 1, PSF1, RING 4, RING4, TAP 1, TAP1*0102N, TAP1N, Transporter 1ATP Binding cassette sub Family B (MDR/TAP), Transporter 1 ATP Binding cassette sub Family B, Transporter 1 ATP Binding Cassette Sub-Family B, Transporter Associated with antigen processing, Transporter ATP Binding cassette major histocompatibility Complex 1, Y3)
254303 100 µL

TAP1 (ABC 17, ABC Transporter MHC 1, ABC17, ABCB 2, ABCB2, Antigenpeptide Transporter 1, APT 1, APT1, ATP Binding cassette sub Family B (MDR/TAP) Member2, ATP Binding cassette sub Family B Member 2, ATP Binding cassette Transporter, D6S114E, FLJ26666, FLJ41500, Peptide supply Factor 1, PeptideTransporter involved in antigen processing 1, Peptide Transporter PSF 1, Peptide Transporter PSF1, Peptide Transporter TAP 1, Peptide Transporter TAP1, PSF 1, PSF1, RING 4, RING4, TAP 1, TAP1*0102N, TAP1N, Transporter 1ATP Binding cassette sub Family B (MDR/TAP), Transporter 1 ATP Binding cassette sub Family B, Transporter 1 ATP Binding Cassette Sub-Family B, Transporter Associated with antigen processing, Transporter ATP Binding cassette major histocompatibility Complex 1, Y3)

Sign In for Pricing
View Details
FUT11/FucT-XI Antibody Blocking Peptide
orb1514307 500 µg

FUT11/FucT-XI Antibody Blocking Peptide

Sign In for Pricing
View Details
MalZ Antibody
orb817982 2 mg

MalZ Antibody

Sign In for Pricing
View Details
Anti-Phospho-Cytokeratin 8 (Ser23) Polyclonal Antibody
TMAB-10568-01 50 μL

Anti-Phospho-Cytokeratin 8 (Ser23) Polyclonal Antibody

Sign In for Pricing
View Details