Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALX4 Rabbit Polyclonal Antibody (Biotin)

ALX4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CRS5, FND2

UniProt

Q9H161

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ALX4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NeuN Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1582421 100 µL

NeuN Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
APG4B Rabbit Polyclonal Antibody (FITC)
orb2135038 100 µL

APG4B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Spmap2 Pre-designed siRNA Set A
SI113730A 1 Each

Mouse Spmap2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
EIF4G1, ID (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (FITC)
MBS6475344-01 0.2 mL

EIF4G1, ID (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (FITC)

Sign In for Pricing
View Details
EIF4G1, ID (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (FITC)
MBS6475344-02 5x 0.2 mL

EIF4G1, ID (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (FITC)

Sign In for Pricing
View Details
Syntrophin-2 Rabbit Polyclonal Antibody (Biotin)
orb456463 100 µL

Syntrophin-2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details