Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tollip Rabbit Polyclonal Antibody (FITC)

Tollip Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4930403G24Rik, 4931428G15Rik

UniProt

Q9QZ06

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGTVG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076253

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPD (ERCC2) (NM_000400) Human Over-expression Lysate
LY400141 100 µg

XPD (ERCC2) (NM_000400) Human Over-expression Lysate

Sign In for Pricing
View Details
Maackia amurensis Gel -MAA- Immobilized Lectin
A-7801-2 2 mL

Maackia amurensis Gel -MAA- Immobilized Lectin

Sign In for Pricing
View Details
Cd82 Mouse Gene Knockout Kit (CRISPR)
KN502943 1 Kit

Cd82 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF594 conjugate, 0.1mg/mL
BNC942434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PKSH030447-01 100 µg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PKSH030447-02 1 mg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Sign In for Pricing
View Details