Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP106 Rabbit Polyclonal Antibody (FITC)

ZFP106 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SH3BP3, ZFP106, ZNF474

UniProt

Q9H2Y7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP106

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

209kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_071918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag
056191-01 10 µg

Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag
056191-02 50 µg

Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag
056191-03 100 µg

Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag
056191-04 200 µg

Cluster Of Differentiation 33 (CD33), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)
MBS7013181-01 0.02 mg

Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)

Sign In for Pricing
View Details
Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)
MBS7013181-02 0.1 mg

Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)

Sign In for Pricing
View Details