Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP106 Rabbit Polyclonal Antibody (FITC)

ZFP106 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SH3BP3, ZFP106, ZNF474

UniProt

Q9H2Y7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP106

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

209kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_071918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Protein FAM186A, FAM186A ELISA KIT
ELI-32931m 96 Tests

Mouse Protein FAM186A, FAM186A ELISA KIT

Sign In for Pricing
View Details
Polyclonal F2RL3 / PAR4 Antibody (Extracellular Domain)
APR15906G 0.05mg

Polyclonal F2RL3 / PAR4 Antibody (Extracellular Domain)

Sign In for Pricing
View Details
Sep SCX10μm2.1x50mm
HCA100U021X050H3A 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Sep SCX10μm2.1x50mm

Sign In for Pricing
View Details
Magnesium Chloride Hexahydrate for tissue culture, 99.5%
16203-01 500 g

Magnesium Chloride Hexahydrate for tissue culture, 99.5%

Sign In for Pricing
View Details
Magnesium Chloride Hexahydrate for tissue culture, 99.5%
16203-02 5 Kg

Magnesium Chloride Hexahydrate for tissue culture, 99.5%

Sign In for Pricing
View Details
Lymphocyte Antigen 75 (LY75, Ly-75, CD205, C-type Lectin Domain Family 13 Member B, CLEC13B, DEC-205, gp200-MR6) (AP) discontinued
L8004-25-AP 200 µL

Lymphocyte Antigen 75 (LY75, Ly-75, CD205, C-type Lectin Domain Family 13 Member B, CLEC13B, DEC-205, gp200-MR6) (AP) discontinued

Sign In for Pricing
View Details