Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bnc1 Rabbit Polyclonal Antibody (Biotin)

Bnc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Bnc, AI047752, AW546376

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ETSEDHFRAAYLLQDVAKEAYQDVAFTPQASQTSVIFKGTSGMGSLVYPI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031588

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAP3K4 Rabbit Monoclonal Antibody
M04842 100 µL/Vial

Anti-MAP3K4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MT1B Antibody, Biotin conjugated
CSB-PA17419D0Rb-01 50 µg

MT1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
MT1B Antibody, Biotin conjugated
CSB-PA17419D0Rb-02 100 µg

MT1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Human CCL25 Protein (Trx Tag)
PDEH100499-01 20 µg

Recombinant Human CCL25 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL25 Protein (Trx Tag)
PDEH100499-02 100 µg

Recombinant Human CCL25 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL25 Protein (Trx Tag)
PDEH100499-03 500 µg

Recombinant Human CCL25 Protein (Trx Tag)

Sign In for Pricing
View Details