Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOX2 Rabbit Polyclonal Antibody (HRP)

SHOX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OG12, SHOT, OG12X

UniProt

O60902

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SHOX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR156 (Probable G-Protein Coupled Receptor 156, G-Protein Coupled Receptor PGR28, GABAB-Related G-Protein Coupled Receptor, GPR156, GABABL, PGR28) (APC)
MBS6456394-01 0.1 mL

GPR156 (Probable G-Protein Coupled Receptor 156, G-Protein Coupled Receptor PGR28, GABAB-Related G-Protein Coupled Receptor, GPR156, GABABL, PGR28) (APC)

Sign In for Pricing
View Details
GPR156 (Probable G-Protein Coupled Receptor 156, G-Protein Coupled Receptor PGR28, GABAB-Related G-Protein Coupled Receptor, GPR156, GABABL, PGR28) (APC)
MBS6456394-02 5x 0.1 mL

GPR156 (Probable G-Protein Coupled Receptor 156, G-Protein Coupled Receptor PGR28, GABAB-Related G-Protein Coupled Receptor, GPR156, GABABL, PGR28) (APC)

Sign In for Pricing
View Details
HIPK2 Rabbit mAb
MBS8603899-01 0.1 mL

HIPK2 Rabbit mAb

Sign In for Pricing
View Details
HIPK2 Rabbit mAb
MBS8603899-02 0.1 mL (AF405L)

HIPK2 Rabbit mAb

Sign In for Pricing
View Details
HIPK2 Rabbit mAb
MBS8603899-03 0.1 mL (AF405S)

HIPK2 Rabbit mAb

Sign In for Pricing
View Details
HIPK2 Rabbit mAb
MBS8603899-04 0.1 mL (AF610)

HIPK2 Rabbit mAb

Sign In for Pricing
View Details