Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAH2 Rabbit Polyclonal Antibody (HRP)

SIAH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSiah2

UniProt

O43255

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SIAH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUB 1 Rabbit Polyclonal Antibody (Carrier-free)
orb3109301 100 µg

TUB 1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Lentiviral mouse Zfp110 shRNA (UAS) - Lentiviral mouse Zfp110 shRNA (UAS, iRFP) plasmid
GTR15239140 1 Vial

Lentiviral mouse Zfp110 shRNA (UAS) - Lentiviral mouse Zfp110 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)
MBS1202531-01 0.02 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)
MBS1202531-02 0.02 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)
MBS1202531-03 0.1 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)
MBS1202531-04 0.1 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 3 tRNA modification GTPase MnmE (mnmE)

Sign In for Pricing
View Details