Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIM2 Rabbit Polyclonal Antibody (FITC)

SIM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIM, bHLHe15, HMC13F06, HMC29C01

UniProt

Q14190

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SIM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPE Rabbit Polyclonal Antibody
orb756548-01 50 µg

CPE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPE Rabbit Polyclonal Antibody
orb756548-02 100 µg

CPE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAD Rabbit Polyclonal Antibody
orb555952 100 µL

CAD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD115/CSF1R Polyclonal Antibody
PHC25201 100 μg

Anti-CD115/CSF1R Polyclonal Antibody

Sign In for Pricing
View Details
HumaCell Human serum (converted) mixed gender mixed blood type - cGMP Grade Heat Inactivated Gamma Irradiated
S-117A-HI-GI-US 500 mL

HumaCell Human serum (converted) mixed gender mixed blood type - cGMP Grade Heat Inactivated Gamma Irradiated

Sign In for Pricing
View Details
NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 650)
MBS6325848-01 0.1 mL

NME1, ID (NME1, NDPKA, NM23, Nucleoside diphosphate kinase A, Granzyme A-activated DNase, Metastasis inhibition factor nm23, Tumor metastatic process-associated protein, nm23-H1) (MaxLight 650)

Sign In for Pricing
View Details