Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIM2 Rabbit Polyclonal Antibody (FITC)

SIM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIM, bHLHe15, HMC13F06, HMC29C01

UniProt

Q14190

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SIM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLTEIEYKELQLSLEQVSTAKSQDSWRTALSTSQETRKLVKPKNTKMKTK

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatase, Alkaline, Placental (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme)
MBS631686-01 1.5 mL

Phosphatase, Alkaline, Placental (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme)

Sign In for Pricing
View Details
Phosphatase, Alkaline, Placental (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme)
MBS631686-02 5x 1.5 mL

Phosphatase, Alkaline, Placental (PLAP, Alkaline Phosphatase Placental, Alkaline Phosphatase Placental Type, ALP, ALPP, Glycerophosphatase, PLAP-1, Regan Isozyme)

Sign In for Pricing
View Details
Anti-CXCL1 Antibody, Mouse Monoclonal
MBS8112678-01 0.1 mL

Anti-CXCL1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CXCL1 Antibody, Mouse Monoclonal
MBS8112678-02 5x 0.1 mL

Anti-CXCL1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
AGK Recombinant Protein (Mouse)
RP114779 100 µg

AGK Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Human HDHD1A Protein
ARP2422-01 10 µg

Recombinant Human HDHD1A Protein

Sign In for Pricing
View Details