Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD4 Rabbit Polyclonal Antibody (Biotin)

JMJD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ12517, MGC129896

UniProt

Q9H9V9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JMJD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APGRVAFVSEPGAFSYADFVRGFLLPNLPCVFSSAFTQGWGSRRRWVTPA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_075383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smarcd3 (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily D Member 3, 60kD BRG-1/Brm-Associated Factor Subunit C, BRG1-Associated Factor 60C, BAF60C, mBAF60c, Smarcd3, Baf60c) (HRP) discontinued
302758-HRP 200 µL

Smarcd3 (SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily D Member 3, 60kD BRG-1/Brm-Associated Factor Subunit C, BRG1-Associated Factor 60C, BAF60C, mBAF60c, Smarcd3, Baf60c) (HRP) discontinued

Sign In for Pricing
View Details
Anti mouse factor XII, clone 5B5
MBS135918-01 0.1 mg

Anti mouse factor XII, clone 5B5

Sign In for Pricing
View Details
Anti mouse factor XII, clone 5B5
MBS135918-02 1 mg

Anti mouse factor XII, clone 5B5

Sign In for Pricing
View Details
Anti mouse factor XII, clone 5B5
MBS135918-03 5x 1 mg

Anti mouse factor XII, clone 5B5

Sign In for Pricing
View Details
Rac Loxoprofen sodium-d3
TMIH-0472-01 1 mg

Rac Loxoprofen sodium-d3

Sign In for Pricing
View Details
Rac Loxoprofen sodium-d3
TMIH-0472-02 5 mg

Rac Loxoprofen sodium-d3

Sign In for Pricing
View Details