Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF447 Rabbit Polyclonal Antibody (HRP)

ZNF447 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF447

UniProt

Q8TBC5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF447

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox6b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16708114 3x 1.0 µg

Cox6b2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Nucleophosmin (NPM1) (NM_002520) Human Over-expression Lysate
LC419282 20 µg

Nucleophosmin (NPM1) (NM_002520) Human Over-expression Lysate

Sign In for Pricing
View Details
TNIK (TRAF2 and NCK-interacting Protein Kinase, KIAA0551) (MaxLight 650)
MBS6225140-01 0.1 mL

TNIK (TRAF2 and NCK-interacting Protein Kinase, KIAA0551) (MaxLight 650)

Sign In for Pricing
View Details
TNIK (TRAF2 and NCK-interacting Protein Kinase, KIAA0551) (MaxLight 650)
MBS6225140-02 5x 0.1 mL

TNIK (TRAF2 and NCK-interacting Protein Kinase, KIAA0551) (MaxLight 650)

Sign In for Pricing
View Details
Bcl-x (h) -PR
sc-77361-PR 10 µM - 20 µL

Bcl-x (h) -PR

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Transcription-repair-coupling factor (mfd), partial
MBS1307327 Inquire

Recombinant Rickettsia bellii Transcription-repair-coupling factor (mfd), partial

Sign In for Pricing
View Details