Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit Polyclonal Antibody (Biotin)

SMARCD2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

UniProt

B4DV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCD2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit
MBS7606982-01 48 Well

Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit

Sign In for Pricing
View Details
Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit
MBS7606982-02 96 Well

Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit

Sign In for Pricing
View Details
Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit
MBS7606982-03 5x 96 Well

Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit

Sign In for Pricing
View Details
Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit
MBS7606982-04 10x 96 Well

Human PDE7B (cAMP-specific 3',5'-cyclic phosphodiesterase 7B) ELISA Kit

Sign In for Pricing
View Details
S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (APC)
MBS6242556-01 0.1 mL

S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (APC)

Sign In for Pricing
View Details
S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (APC)
MBS6242556-02 5x 0.1 mL

S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (APC)

Sign In for Pricing
View Details