Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit Polyclonal Antibody (FITC)

SMARCD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

UniProt

B4DV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d10c sgRNA CRISPR Lentivector set (Rat)
K6384501 3x 1.0 µg

Tbc1d10c sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DOCK7 (Dedicator of Cytokinesis 7, 3110056M06Rik, Gm430, KIAA1771, MGC189434, mKIAA1771, RP23-329P19.2, ZIR2) discontinued
D8077-40 100 µg

DOCK7 (Dedicator of Cytokinesis 7, 3110056M06Rik, Gm430, KIAA1771, MGC189434, mKIAA1771, RP23-329P19.2, ZIR2) discontinued

Sign In for Pricing
View Details
ERGIC1 (NM_001031711) Human 3' UTR Clone
SC216870 10 µg

ERGIC1 (NM_001031711) Human 3' UTR Clone

Sign In for Pricing
View Details
Lentiviral human LGSN sgRNA gene knockout kit - Lentiviral human LGSN sgRNA gene knockout kit (25)
GTR15377280 1 Vial

Lentiviral human LGSN sgRNA gene knockout kit - Lentiviral human LGSN sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Canine Galectin 2 ELISA Kit
MBS741152-01 48 Well

Canine Galectin 2 ELISA Kit

Sign In for Pricing
View Details
Canine Galectin 2 ELISA Kit
MBS741152-02 96 Well

Canine Galectin 2 ELISA Kit

Sign In for Pricing
View Details