Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit Polyclonal Antibody (HRP)

SMARCD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

UniProt

B4DV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Testosterone 17-β-Dehydrogenase 3 (HSD17B3) Mouse ELISA Kit
H5242 96 Tests

Testosterone 17-β-Dehydrogenase 3 (HSD17B3) Mouse ELISA Kit

Sign In for Pricing
View Details
[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid
FD183062-01 0.1 g

[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid

Sign In for Pricing
View Details
[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid
FD183062-02 0.25 g

[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid

Sign In for Pricing
View Details
[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid
FD183062-03 0.5 g

[4- (3,6-Dimethyl-9H-carbazol-9-yl) butyl]phosphonic acid

Sign In for Pricing
View Details
SLC26A1 (NM_213613) Human Tagged Lenti ORF Clone
RC217255L2 10 µg

SLC26A1 (NM_213613) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NUDT9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1464905 3x 1.0 µg

NUDT9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details