Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit Polyclonal Antibody (HRP)

SMARCD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

UniProt

B4DV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMARCD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vicia villosa Lectin (VVL/VVA) - Texas Red
21510204-1 1 mg

Vicia villosa Lectin (VVL/VVA) - Texas Red

Sign In for Pricing
View Details
C7orf30 Rabbit Polyclonal Antibody (BF405)
orb2507933 100 µL

C7orf30 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial
MBS9018338-01 0.02 mg (E-Coli)

Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial

Sign In for Pricing
View Details
Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial
MBS9018338-02 0.02 mg (Yeast)

Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial

Sign In for Pricing
View Details
Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial
MBS9018338-03 0.1 mg (E-Coli)

Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial

Sign In for Pricing
View Details
Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial
MBS9018338-04 0.1 mg (Yeast)

Recombinant Glycine max Beta-conglycinin alpha' subunit (CG-1), partial

Sign In for Pricing
View Details