Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX15 Rabbit Polyclonal Antibody (HRP)

SOX15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SOX20, SOX26, SOX27

UniProt

O60248

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOX15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angptl2 Mouse Gene Knockout Kit (CRISPR)
KN501240 1 Kit

Angptl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADCK2 Antibody
8C11266-AAT 50 µg

ADCK2 Antibody

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), 0.2mg/mL
BNUB2550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), 0.2mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), 1mg/mL
BNUM1126-50 1x 50 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS622371 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
FYN (NM_153047) Human Over-expression Lysate
LY403505 100 µg

FYN (NM_153047) Human Over-expression Lysate

Sign In for Pricing
View Details