Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX12 Rabbit Polyclonal Antibody (FITC)

SOX12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SOX22

UniProt

O15370

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SOX12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_008874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSDMD Mouse Monoclonal Antibody (Fluoro550)
orb3084678 100 µg

GSDMD Mouse Monoclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
RSL1D1 Rabbit Polyclonal Antibody (Cy3)
orb983483 100 µL

RSL1D1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2056907-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2056907-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2056907-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2056907-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details