Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPC1 Rabbit Polyclonal Antibody (HRP)

EPC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Epl1

UniProt

Q9H2F5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EPC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VNKQDKADLIRPKRKYEKKPKVLPSSAAATPQQTSPAALPVFNAKDLNQY

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cynomolgus PD-L1 (C-Fc)
PHV1973-01 10 µg

Recombinant Cynomolgus PD-L1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Cynomolgus PD-L1 (C-Fc)
PHV1973-02 50 µg

Recombinant Cynomolgus PD-L1 (C-Fc)

Sign In for Pricing
View Details
Recombinant Cynomolgus PD-L1 (C-Fc)
PHV1973-03 500 µg

Recombinant Cynomolgus PD-L1 (C-Fc)

Sign In for Pricing
View Details
CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)
125316-ML490 100 µL

CREB3L2 (BBF2H7, Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, BBF2 Human Homolog on Chromosome 7, Processed Cyclic AMP-responsive Element-binding Protein 3-like Protein 2, MGC131709, MGC71006) (MaxLight 490)

Sign In for Pricing
View Details
Goat anti-Dog IgA Fc specific, HRP conjugated
AS16 3118 10 mg

Goat anti-Dog IgA Fc specific, HRP conjugated

Sign In for Pricing
View Details
DRG1 Antibody
orb1257781 100 µL

DRG1 Antibody

Sign In for Pricing
View Details