Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING3 Rabbit Polyclonal Antibody (HRP)

ING3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eaf4, ING2, MEAF4, p47ING3

UniProt

Q9NXR8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ING3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_061944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Peripherin ELISA Kit
MBS7273053-01 48 Well

Sheep Peripherin ELISA Kit

Sign In for Pricing
View Details
Sheep Peripherin ELISA Kit
MBS7273053-02 96 Well

Sheep Peripherin ELISA Kit

Sign In for Pricing
View Details
Sheep Peripherin ELISA Kit
MBS7273053-03 5x 96 Well

Sheep Peripherin ELISA Kit

Sign In for Pricing
View Details
Sheep Peripherin ELISA Kit
MBS7273053-04 10x 96 Well

Sheep Peripherin ELISA Kit

Sign In for Pricing
View Details
Lentiviral human MRPL40 shRNA (UAS) - Lentiviral human MRPL40 shRNA (UAS) plasmid
GTR15350074 1 Vial

Lentiviral human MRPL40 shRNA (UAS) - Lentiviral human MRPL40 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ZNF202 (Zinc Finger Protein 202, Zinc Finger Protein with KRAB and SCAN Domains 10, ZKSCAN 10, ZKSCAN10, ZNF 202) (Azide Free) (MaxLight 750)
MBS6231195-01 0.1 mL

ZNF202 (Zinc Finger Protein 202, Zinc Finger Protein with KRAB and SCAN Domains 10, ZKSCAN 10, ZKSCAN10, ZNF 202) (Azide Free) (MaxLight 750)

Sign In for Pricing
View Details