Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps72 Rabbit Polyclonal Antibody (FITC)

Vps72 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

YL-, Tcfl, YL-1, Tcfl1

UniProt

Q62481

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap17a ORF Vector (Rat) (pORF)
ORF063237 1.0 µg DNA

Akap17a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Capsule Filter, Polypropylene,10.0μm, Gen Purpose, Not Sterile,2100cm2,1/2" NPT-M, None, Bag label
CSKPP1000GN212NMNN0 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Capsule Filter, Polypropylene,10.0μm, Gen Purpose, Not Sterile,2100cm2,1/2" NPT-M, None, Bag label

Sign In for Pricing
View Details
Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial
RPC23284-01 20 µg

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial

Sign In for Pricing
View Details
Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial
RPC23284-02 100 µg

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial

Sign In for Pricing
View Details
Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial
RPC23284-03 1 mg

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial

Sign In for Pricing
View Details
Human Caspase 9 (CASP9) ELISA Kit
RD-CASP9-Hu-96Tests 96 Tests

Human Caspase 9 (CASP9) ELISA Kit

Sign In for Pricing
View Details