Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps72 Rabbit Polyclonal Antibody (HRP)

Vps72 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YL-, Tcfl, YL-1, Tcfl1

UniProt

Q62481

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)
MBS6208936-01 0.1 mL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)

Sign In for Pricing
View Details
TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)
MBS6208936-02 5x 0.1 mL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (MaxLight 490)

Sign In for Pricing
View Details
GNPAT discontinued
389641 200 µL

GNPAT discontinued

Sign In for Pricing
View Details
KLHDC4 (Kelch Domain-containing Protein 4, DKFZp434G0522, FLJ00104)
128865 100 µg

KLHDC4 (Kelch Domain-containing Protein 4, DKFZp434G0522, FLJ00104)

Sign In for Pricing
View Details
3- (Cycloheptylsulfamoyl) thiophene-2-carboxylic acid
UMB89450-01 100 mg

3- (Cycloheptylsulfamoyl) thiophene-2-carboxylic acid

Sign In for Pricing
View Details
3- (Cycloheptylsulfamoyl) thiophene-2-carboxylic acid
UMB89450-02 1 g

3- (Cycloheptylsulfamoyl) thiophene-2-carboxylic acid

Sign In for Pricing
View Details