Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF20 Rabbit Polyclonal Antibody (FITC)

C20ORF20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Eaf7, URCC4, MRG15BP, C20orf20

UniProt

Q9NV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20ORF20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC
MBS1488605-01 0.05 mg

Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC
MBS1488605-02 0.1 mg

Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC
MBS1488605-03 5x 0.1 mg

Rabbit anti-human STAM-binding protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
Mouse Galectin 8 (GAL8) ) ELISA Kit
QY-E20630 96 Tests

Mouse Galectin 8 (GAL8) ) ELISA Kit

Sign In for Pricing
View Details
FIGN Protein Lysate (Rat) with C-HA Tag
20559036 100 µg

FIGN Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ZBTB8B CRISPRa sgRNA lentivector (set of three targets)(Rat)
50726126 3x 1.0µg DNA

ZBTB8B CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details