Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF20 Rabbit Polyclonal Antibody (FITC)

C20ORF20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Eaf7, URCC4, MRG15BP, C20orf20

UniProt

Q9NV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20ORF20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IL-21R (4A9) In Vivo Antibody - Low Endotoxin
ICH1206-100mg 100 mg

Anti-Mouse IL-21R (4A9) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Mouse Kcnk10 Pre-designed siRNA Set A
SI107060A 1 Each

Mouse Kcnk10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Slc5a1 (NM_019810) Mouse Tagged Lenti ORF Clone
MR209884L3 10 µg

Slc5a1 (NM_019810) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VWA7 (NM_025258) Human Tagged ORF Clone
RC223553 10 µg

VWA7 (NM_025258) Human Tagged ORF Clone

Sign In for Pricing
View Details
S1R agonist 1 hydrochloride
C8485-10 10 mg

S1R agonist 1 hydrochloride

Sign In for Pricing
View Details
C11orf30 (EMSY, Protein EMSY, FLJ90741, GL002) (APC)
124065-APC 100 µL

C11orf30 (EMSY, Protein EMSY, FLJ90741, GL002) (APC)

Sign In for Pricing
View Details