Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF20 Rabbit Polyclonal Antibody (HRP)

C20ORF20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eaf7, URCC4, MRG15BP, C20orf20

UniProt

Q9NV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20ORF20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Glutamic acid
RM1503-25G 1 unit

D-Glutamic acid

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin G (SEG) (PE)
MBS6129604-01 0.1 mL

Staphylococcus aureus Enterotoxin G (SEG) (PE)

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin G (SEG) (PE)
MBS6129604-02 5x 0.1 mL

Staphylococcus aureus Enterotoxin G (SEG) (PE)

Sign In for Pricing
View Details
MAP2K6/MKK6 (Mitogen Activated Protein Kinase Kinase 6) Chicken ELISA Kit
E8512 96 Tests

MAP2K6/MKK6 (Mitogen Activated Protein Kinase Kinase 6) Chicken ELISA Kit

Sign In for Pricing
View Details
C6orf223 Antibody (FITC)
orb45312-01 50 µg

C6orf223 Antibody (FITC)

Sign In for Pricing
View Details
C6orf223 Antibody (FITC)
orb45312-02 100 µg

C6orf223 Antibody (FITC)

Sign In for Pricing
View Details