Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF20 Rabbit Polyclonal Antibody (Biotin)

C20ORF20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Eaf7, URCC4, MRG15BP, C20orf20

UniProt

Q9NV56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C20ORF20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-
H-8006-1 1 mg

HRP Conjugated Narcissus pseudonarcissus Lectin (Daffodil) -NPA-

Sign In for Pricing
View Details
Slc35e4 Mouse Gene Knockout Kit (CRISPR)
KN516071 1 Kit

Slc35e4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATXN10 (NM_001167621) Human Over-expression Lysate
LY433029 100 µg

ATXN10 (NM_001167621) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC27A4 Antibody
8C16490-AAT 50 µg

SLC27A4 Antibody

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF405S conjugate, 0.1mg/mL
BNC042474-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB516283 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details