Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAF6 Rabbit Polyclonal Antibody (FITC)

MEAF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EAF6, CENP-28, C1orf149, NY-SAR-91

UniProt

Q9HAF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EAF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASST

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Aquaporin 5 ELISA Kit
MBS738735-01 48 Well

Bovine Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Aquaporin 5 ELISA Kit
MBS738735-02 96 Well

Bovine Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Aquaporin 5 ELISA Kit
MBS738735-03 5x 96 Well

Bovine Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
Bovine Aquaporin 5 ELISA Kit
MBS738735-04 10x 96 Well

Bovine Aquaporin 5 ELISA Kit

Sign In for Pricing
View Details
LAMP2 (Lysosome-associated Membrane Glycoprotein 2, LAMP-2, Lysosome-associated Membrane Protein 2, CD107 Antigen-like Family Member B, CD107b) (FITC)
128994-FITC 100 µL

LAMP2 (Lysosome-associated Membrane Glycoprotein 2, LAMP-2, Lysosome-associated Membrane Protein 2, CD107 Antigen-like Family Member B, CD107b) (FITC)

Sign In for Pricing
View Details
CUX2 Human Pre-designed siRNA Set A
HY-RS03370 1 Set

CUX2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details