Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAF6 Rabbit Polyclonal Antibody (HRP)

MEAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EAF6, CENP-28, C1orf149, NY-SAR-91

UniProt

Q9HAF1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIEKREPGSGTESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASST

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copine-3 (CPNE3) Antibody (HRP)
abx341596-01 20 µg

Copine-3 (CPNE3) Antibody (HRP)

Sign In for Pricing
View Details
Copine-3 (CPNE3) Antibody (HRP)
abx341596-02 50 µg

Copine-3 (CPNE3) Antibody (HRP)

Sign In for Pricing
View Details
Copine-3 (CPNE3) Antibody (HRP)
abx341596-03 100 µg

Copine-3 (CPNE3) Antibody (HRP)

Sign In for Pricing
View Details
Copine-3 (CPNE3) Antibody (HRP)
abx341596-04 200 µg

Copine-3 (CPNE3) Antibody (HRP)

Sign In for Pricing
View Details
Copine-3 (CPNE3) Antibody (HRP)
abx341596-05 1 mg

Copine-3 (CPNE3) Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Cupriavidus taiwanensis Cytidylate kinase (cmk)
MBS1231632-01 0.02 mg (E-Coli)

Recombinant Cupriavidus taiwanensis Cytidylate kinase (cmk)

Sign In for Pricing
View Details