Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR4 Rabbit Polyclonal Antibody (HRP)

SSTR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SS4R, SS4-R, SS-4-R

UniProt

P31391

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSTR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (APC)
MBS6477669-01 0.1 mL

GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (APC)

Sign In for Pricing
View Details
GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (APC)
MBS6477669-02 5x 0.1 mL

GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (APC)

Sign In for Pricing
View Details
DHX16 Antibody Biotin Conjugated
orb3157122 100 µg

DHX16 Antibody Biotin Conjugated

Sign In for Pricing
View Details
GIPC1, NT (GIPC1, C19orf3, GIPC, RGS19IP1, PDZ domain-containing protein GIPC1, GAIP C-terminus-interacting protein, RGS-GAIP-interacting protein, RGS19-interacting protein 1, Tax interaction protein 2) (APC)
MBS6302282-01 0.2 mL

GIPC1, NT (GIPC1, C19orf3, GIPC, RGS19IP1, PDZ domain-containing protein GIPC1, GAIP C-terminus-interacting protein, RGS-GAIP-interacting protein, RGS19-interacting protein 1, Tax interaction protein 2) (APC)

Sign In for Pricing
View Details
GIPC1, NT (GIPC1, C19orf3, GIPC, RGS19IP1, PDZ domain-containing protein GIPC1, GAIP C-terminus-interacting protein, RGS-GAIP-interacting protein, RGS19-interacting protein 1, Tax interaction protein 2) (APC)
MBS6302282-02 5x 0.2 mL

GIPC1, NT (GIPC1, C19orf3, GIPC, RGS19IP1, PDZ domain-containing protein GIPC1, GAIP C-terminus-interacting protein, RGS-GAIP-interacting protein, RGS19-interacting protein 1, Tax interaction protein 2) (APC)

Sign In for Pricing
View Details
DUXAP6 ORF Vector (Human) (pORF)
ORF018605 1.0 µg DNA

DUXAP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details