Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR4 Rabbit Polyclonal Antibody (HRP)

SSTR4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SS4R, SS4-R, SS-4-R

UniProt

P31391

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSTR4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD59 Antibody (3M173)
TMAY-03808 100 µL

Anti-CD59 Antibody (3M173)

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2705325-01 24 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2705325-02 48 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2705325-03 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2705325-04 5x 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details
Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit
MBS2705325-05 10x 96 Strip Well

Rat Adrenergic Receptor Alpha 2C (ADRa2C) ELISA Kit

Sign In for Pricing
View Details